Skip to content

issues Search Results · language:Edge language:Python language:JavaScript language:Python language:Python

Filter by

40.8M results  (880 ms)

40.8M results

Hi, I ve been trying to run CIF direct template example from the documentation:- { queries : { my_protein : { chains : [ { molecule_type : protein , chain_ids : [ A , B ], sequence : XRMKQLEDKVEELLSKNYHLENEVARLKKLVGER ...
bug
needs-triage

Linear: PUL-37 — https://linear.app/puls-gpw/issue/PUL-37 Symptom After refreshing the page (F5) in the dashboard, analyses/announcements stop loading — the table stays empty. Repro 1. Log in to the ...
bug

Consider the ambiguous (yet somewhat useful) type: T | list[T]. It is problematic since given any list, e.g., list[int], it can bind T to int, which is the expected behavior, or to list[int], which is ...
bug

Linear: PUL-36 — https://linear.app/puls-gpw/issue/PUL-36 Problem The Deploy workflow logs a GitHub deprecation warning: actions/checkout@v4, astral-sh/setup-uv@v6, google-github-actions/auth@v2, google-github-actions/setup-gcloud@v2 ...
enhancement

Objective Single tracking index for the 2026-06-15 documentation-vs-code drift/duplication audit of Tanergy2, run with two independent model passes (Opus 4.8 semantic + Sonnet mechanical scan) and re-verified ...
area:foundation
documentation
priority:p2
risk:low
work-pack

As a developer I need to create a CD pipeline to automate deployment to Kubernetes So that the developers are not wasting their time doing it manually Assumptions - Use Tekton to define the pipeline ...
enhancement

The authentication logic currently maintains API key definitions in multiple locations. This can lead to inconsistent configuration and make future authentication changes harder to maintain. Proposed ...

Single-line stale reference in the multi-site usage walkthrough — continuing the sweep from PRs #109 / #114 / #118 / #120 / #122 / #125 / #128 / #130 / #135 / #137 / #140. `frontend/README.md:1339`: ...

원본 요청 (verbatim) 다이제스트의 글 내용을 선택한 언어에 맞게 자동으로 저장된 통역 글로 보여주기. 저장된 내용없으면 그 언어로 번역 (맥락) 다이제스트(회고 다이제스트) 글 내용을 사용자가 대시보드에서 선택한 언어로 보여주기. 저장된 번역본이 있으면 그걸 보여주고, 없으면 해당 언어로 번역해서 표시(가능하면 번역 결과를 저장해 재사용). 현재는 ...

Source: usernode admin (snait) Change the name of the Usernode Feedback app to : Build something fun
usernode
Issue origami icon

Learn how you can use GitHub Issues to plan and track your work.

Save views for sprints, backlogs, teams, or releases. Rank, sort, and filter issues to suit the occasion. The possibilities are endless.Learn more about GitHub Issues
ProTip! Restrict your search to the title by using the in:title qualifier.
Issue origami icon

Learn how you can use GitHub Issues to plan and track your work.

Save views for sprints, backlogs, teams, or releases. Rank, sort, and filter issues to suit the occasion. The possibilities are endless.Learn more about GitHub Issues
ProTip! Restrict your search to the title by using the in:title qualifier.